DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and psma7

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_989071.1 Gene:psma7 / 394668 XenbaseID:XB-GENE-974596 Length:248 Species:Xenopus tropicalis


Alignment Length:258 Identity:80/258 - (31%)
Similarity:132/258 - (51%) Gaps:34/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTIEK 72
            ||.:.:.|||||.:||::||.:||:|..|.:|:|||:.|||.|||...:||.:.....:|..:::
 Frog     3 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKEIVVLGVEKKSVAKLQDERTVRKICALDE 67

  Fly    73 NIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSII 137
            |:.||.|||.||...|.:.||.|..::|...|..:.::::...:|.....||..:..||||:|.:
 Frog    68 NVFMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISAL 132

  Fly   138 LASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEKLKMD--MRTD------------E 188
            :..:|....|:||:.:|||:...:.|.|.|:..:..:..:||...|  :.||            |
 Frog   133 IVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKHYTDEAIETDDLTIKLVIKALLE 197

  Fly   189 LVESAGEIIYKVHDELKDKDFRFEMGLVGRVTGGLHLINPSELTEKARKAGDAANKDEDSDNE 251
            :|:|.|:.|              |:.::.| ...|.::||.|:....     |..:.|..:||
 Frog   198 VVQSGGKNI--------------ELAVMRR-DQPLKILNPEEIERYV-----AEIEKEKEENE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 71/221 (32%)
PRE1 6..231 CDD:223711 75/236 (32%)
psma7NP_989071.1 proteasome_alpha_type_7 3..211 CDD:239724 71/221 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.