DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and Prosbeta5R1

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_611776.1 Gene:Prosbeta5R1 / 37690 FlyBaseID:FBgn0034842 Length:315 Species:Drosophila melanogaster


Alignment Length:239 Identity:56/239 - (23%)
Similarity:93/239 - (38%) Gaps:43/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIF--TIEKNIGM--AVAGLVAD----GNFVADIA 92
            |.:|.:.:..|:|..:...||..|   .|.:..  .:|.|..|  .:||..||    ...:|...
  Fly    73 TTLGFKYRGGVILCADSRATSGQY---IGSQTMRKIVELNDYMLGTLAGGAADCVYWDRVLAKEC 134

  Fly    93 RQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGL--SIILASWDEVEGPQLYKIEPS 155
            |.....||::.......:.:|:....|          :..||  .::||.:|: |||:|..::..
  Fly   135 RLHQLRYRKRMTVDTAARIICNISTEY----------KGMGLVMGMMLAGFDD-EGPKLIYVDSE 188

  Fly   156 G-SSFG-YFACASGKAKQLAKTEMEKLKMDMRTDELVESAGEIIYKVHDELKDKDFRFEMGLVG- 217
            | .|.| .|:..||....|...: ...:.|:...|..:.|...||  |...||   .:..|:|. 
  Fly   189 GMRSHGQVFSVGSGSPYALGVLD-TGYRYDLSDQEAYDLARRAIY--HATSKD---AYSGGIVRL 247

  Fly   218 ---RVTGGLHLINP--SELTEKARKAGDAANKDE-----DSDNE 251
               ...|..::.|.  |:|.:....:|...|:.:     |.||:
  Fly   248 YHIHSEGWRNICNTDCSDLHDSYCASGCPGNEKDVGNVGDPDND 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 46/191 (24%)
PRE1 6..231 CDD:223711 50/212 (24%)
Prosbeta5R1NP_611776.1 PTZ00488 39..272 CDD:185666 51/218 (23%)
proteasome_beta_type_5 72..259 CDD:239730 48/205 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440914
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.