DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and Prosalpha3

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster


Alignment Length:261 Identity:78/261 - (29%)
Similarity:131/261 - (50%) Gaps:18/261 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYE---PDAGGRIFT 69
            ||...:.|||:||::|::||.:|:..:||.:||..:|.::||.|...|:||.:   |..  :|:.
  Fly     5 YDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSE--KIYR 67

  Fly    70 IEKNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGL 134
            :..|:..:|||:.:|.|.:....|..|..|:..:.:.||.:.|...:.....|||.|...||||:
  Fly    68 LNDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGV 132

  Fly   135 SIILASWDEVEGPQLYKIEPSGSSFGYFA-CAS---GKAKQLAKTEM-EKLKMDMRTDELVESAG 194
            |::...||...|.|||:.:|||:..|:.| |..   |.|..:.|.|: :|..:.:...:..:.|.
  Fly   133 SLLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDLAI 197

  Fly   195 EIIYKVHDELKDKDFRFEMGLVGRVTGG-----LHLINPSELTEKARKA---GDAANKDEDSDNE 251
            :::....|..|....:.||..:.||...     |...:..:|.||..|.   .:||.|::.:...
  Fly   198 KVLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIEKYTKVQAEAEAAKKEKQAKQP 262

  Fly   252 T 252
            |
  Fly   263 T 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 67/215 (31%)
PRE1 6..231 CDD:223711 70/235 (30%)
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 73/241 (30%)
proteasome_alpha_type_4 3..219 CDD:239721 67/215 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441009
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.