DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and Prosalpha6T

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster


Alignment Length:221 Identity:66/221 - (29%)
Similarity:109/221 - (49%) Gaps:20/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAG---GRIFT 69
            ||...:.:||.||:||::||.:||::....:|::|.|..|||. ...|||    |..   .:|..
  Fly     6 YDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAA-LCRTSK----DTNTLQRKIMP 65

  Fly    70 IEKNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGL 134
            ::.::||::|||.||...|....|.|...||..:....|::.|...:...:...|.....||:|:
  Fly    66 VDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDRRPYGV 130

  Fly   135 SIILASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEKLKM----DMRTDELVESAGE 195
            .:::|.:|| :||.:|::.|:.:.....|.|.|...|.|:|.:|: .|    |...|||:..|  
  Fly   131 GLLVAGYDE-QGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLER-NMESFEDCDMDELICHA-- 191

  Fly   196 IIYKVHDELKDKD---FRFEMGLVGR 218
             |..:...|...|   ....:.:||:
  Fly   192 -IQAIRGSLGSDDVENLTINVAIVGK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 64/217 (29%)
PRE1 6..231 CDD:223711 66/221 (30%)
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 66/221 (30%)
proteasome_alpha_type_1 6..215 CDD:239718 64/218 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441007
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.