DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and Prosbeta5R2

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster


Alignment Length:189 Identity:40/189 - (21%)
Similarity:79/189 - (41%) Gaps:20/189 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITS-KLYEPDAGGRIFTIEKNIGMAVAGLVADGN 86
            |||:     :...|.:|...:..::|.|:...|| ||....:..::..:.:.|....||..||..
  Fly    65 QIDF-----DHGTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAADCT 124

  Fly    87 FVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGL--SIILASWDEVEGPQL 149
            :......:|...:..::::.:|::.....::.....|      :..||  .::||.|.. |||.|
  Fly   125 YWDRALTRECRLHELRYKERLPVQSAAKYISNVAAEY------KGMGLCMGMMLAGWSP-EGPSL 182

  Fly   150 YKIEPSGSSF--GYFACASGKAKQLAKTEMEKLKMDMRTDELVESAGEIIYKVHDELKD 206
            ..::.:|...  ..||..||....|...:.: .::|:..:|..:.|...:|  |..:.|
  Fly   183 VYVDSNGLRIHGKLFAVGSGAPNALGILDSD-YRLDLSDNEAYDLAFLAVY--HATMTD 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 40/189 (21%)
PRE1 6..231 CDD:223711 40/189 (21%)
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 40/189 (21%)
proteasome_beta_type_5 72..259 CDD:239730 37/177 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440915
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.