DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and Prosbeta2R1

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster


Alignment Length:213 Identity:49/213 - (23%)
Similarity:80/213 - (37%) Gaps:48/213 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAG-GRIFTIEKNIGMAVAGLVADGNFVADIA 92
            ||::...:::||..||.|:|..:...|......|.. .:|..::.:|....||..||...:....
  Fly    43 KAIKTGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTT 107

  Fly    93 RQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSIILASWDEVEGPQLYKIEPSGS 157
            ..|...:|...|:.:|:  :|   |..:...||:......|.::::...| ..|||||.|.|.||
  Fly   108 SAELDLHRLNTERRVPV--VC---ASMMLRRTLFRYQGHIGAALVMGGVD-TTGPQLYCIYPCGS 166

  Fly   158 S--FGYFACASG-------------------KAKQLAKTEME--------------------KLK 181
            :  ..|.|..||                   :.|||.:..:.                    |..
  Fly   167 NDKIPYAAMGSGTLAAMSVLEHGWKPDLDLEQGKQLVREAISAGVFNDLGSGSNIDLCVITAKGA 231

  Fly   182 MDMRTDELVESAGEIIYK 199
            :.:|||.:....||.:.|
  Fly   232 VYLRTDTIASEKGERLGK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 49/213 (23%)
PRE1 6..231 CDD:223711 49/213 (23%)
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 44/198 (22%)
proteasome_beta_type_7 49..236 CDD:239732 41/192 (21%)
Pr_beta_C 241..274 CDD:289249 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441013
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.