DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and psmb5

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_571226.1 Gene:psmb5 / 30387 ZFINID:ZDB-GENE-990415-215 Length:269 Species:Danio rerio


Alignment Length:194 Identity:44/194 - (22%)
Similarity:81/194 - (41%) Gaps:39/194 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTIEKNIGM------AVAGLVADGNFVADIARQ 94
            |.:..:.:..|::||:...|:..|....     |::|.|.:      .:||..||.:|...:..:
Zfish    67 TTLAFKFQHGVIVAVDSRATAGAYIASQ-----TVKKVIEINPYLLGTMAGGAADCSFWERLLAR 126

  Fly    95 EAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSI--ILASWDEVEGPQLYKIEPSGS 157
            :...|..:.::.|.:......:|..|:.|      :..|||:  ::..||: .||.||.::..|:
Zfish   127 QCRIYELRNKERISVAAASKLLANMVYQY------KGMGLSMGTMVCGWDK-RGPGLYYVDSEGN 184

  Fly   158 SF--GYFACASGKAKQLAKTEMEKLKMDMRTDELVE---------------SAGEI-IYKVHDE 203
            ..  |.||..||........: ..|:.|:..||..:               |.|:: :|:||.|
Zfish   185 RVCGGLFAVGSGSMYAYGVVD-SGLRYDLTIDEACDLGRRAIYQATYRDAYSGGQVNLYRVHSE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 44/194 (23%)
PRE1 6..231 CDD:223711 44/194 (23%)
psmb5NP_571226.1 PTZ00488 44..268 CDD:185666 44/194 (23%)
proteasome_beta_type_5 66..253 CDD:239730 44/194 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.