DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and Psma5

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_058978.2 Gene:Psma5 / 29672 RGDID:61848 Length:241 Species:Rattus norvegicus


Alignment Length:234 Identity:76/234 - (32%)
Similarity:128/234 - (54%) Gaps:13/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTIEK 72
            ||...:.|||:||:||::||.:|::...|.|||:..:.|.|||||.|||.|.||.:..:|..|:.
  Rat     8 YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDA 72

  Fly    73 NIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSA-----VRPF 132
            :||.|::||:||...:.|.||.|..|:...:.:.:.::.:...|:.....:....|     .|||
  Rat    73 HIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPF 137

  Fly   133 GLSIILASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEKL-KMDMRTDELVESAGEI 196
            |::::....|| :||||:.::|||:.....|.|.|.|.:.|::.:::: ...|...|.::|:..|
  Rat   138 GVALLFGGVDE-KGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLII 201

  Fly   197 IYKVHDELKDKDFRFEMGLV--GRVTGGLHLINPSELTE 233
            :.:|.:| |......|:..|  |:   ..|:....||.|
  Rat   202 LKQVMEE-KLNATNIELATVQPGQ---NFHMFTKEELEE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 70/213 (33%)
PRE1 6..231 CDD:223711 73/230 (32%)
Psma5NP_058978.2 proteasome_alpha_type_5 8..220 CDD:239722 70/213 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.