DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and Psma4

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_058977.1 Gene:Psma4 / 29671 RGDID:61846 Length:261 Species:Rattus norvegicus


Alignment Length:252 Identity:73/252 - (28%)
Similarity:127/252 - (50%) Gaps:11/252 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLY-EPDAGGRIFTIE 71
            ||...:.|||:||::|::||.:|:..:||.:||...|.|:||.|:....||. |.....:|:.:.
  Rat     5 YDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLN 69

  Fly    72 KNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSI 136
            :::..:|||:.:|.|.:.:..|..|..|..|:::.||.:.|...:.....|||.:...||||:|:
  Rat    70 EDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSL 134

  Fly   137 ILASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEKLKMDMRTDEL-----VESAGEI 196
            :...||:..|.|||:.:|||:..|:.|...|.....|   :..||.|.:..|:     :..|.::
  Rat   135 LYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAA---VSMLKQDYKEGEMTLKSALALAVKV 196

  Fly   197 IYKVHDELKDKDFRFEMGLVGRVTGG--LHLINPSELTEKARKAGDAANKDEDSDNE 251
            :.|..|..|....:.|:..:.|..|.  :.::...|:.:..:|..:...|.|....|
  Rat   197 LNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 66/213 (31%)
PRE1 6..231 CDD:223711 68/230 (30%)
Psma4NP_058977.1 proteasome_alpha_type_4 3..216 CDD:239721 66/213 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.