DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and Psma1

DIOPT Version :10

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_058974.1 Gene:Psma1 / 29668 RGDID:61841 Length:263 Species:Rattus norvegicus


Alignment Length:217 Identity:61/217 - (28%)
Similarity:111/217 - (51%) Gaps:11/217 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTIEK 72
            ||...:.:||.||:.||:||.:||::....:|::.|...||...|...|:|.....  :|..::.
  Rat     6 YDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQK--KILHVDN 68

  Fly    73 NIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSII 137
            :||:::|||.||...:.:..|||..:.|..|::.:|:..|...:.......|.....||:|:.::
  Rat    69 HIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLL 133

  Fly   138 LASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEKLK---MDMRTDELVESAGEIIYK 199
            :|.:|:: ||.:::..||.:.|...|.:.|...|.|:|.:|:..   |....||||:.....:.:
  Rat   134 IAGYDDM-GPHVFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMQCNLDELVKHGLRALRE 197

  Fly   200 ---VHDELKDKDFRFEMGLVGR 218
               ...:|..|:  ..:|:||:
  Rat   198 TLPAEQDLTTKN--VSIGIVGK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 59/213 (28%)
Psma1NP_058974.1 proteasome_alpha_type_1 6..216 CDD:239718 59/214 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..263
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.