DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and Psmb5

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001099197.2 Gene:Psmb5 / 29425 RGDID:61879 Length:263 Species:Rattus norvegicus


Alignment Length:173 Identity:37/173 - (21%)
Similarity:74/173 - (42%) Gaps:21/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTIEKNIGM------AVAGLVADGNFVADIARQ 94
            |.:..:.:..|::|.:...|:..|....     |::|.|.:      .:||..||.:|...:..:
  Rat    61 TTLAFKFQHGVIVAADSRATAGAYIASQ-----TVKKVIEINPYLLGTMAGGAADCSFWERLLAR 120

  Fly    95 EAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSI--ILASWDEVEGPQLYKIEPSGS 157
            :...|..:.::.|.:......:|..|:.|      :..|||:  ::..||: .||.||.::..|:
  Rat   121 QCRIYELRNKERISVAAASKLLANMVYQY------KGMGLSMGTMICGWDK-RGPGLYYVDSEGN 178

  Fly   158 SFGYFACASGKAKQLAKTEMEK-LKMDMRTDELVESAGEIIYK 199
            .....|.:.|.....|...|:: ...|::.:|..:.|...||:
  Rat   179 RISGTAFSVGSGSVYAFGVMDRGYSYDLQVEEAYDLARRAIYQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 37/173 (21%)
PRE1 6..231 CDD:223711 37/173 (21%)
Psmb5NP_001099197.2 PTZ00488 29..263 CDD:185666 37/173 (21%)
proteasome_beta_type_5 60..247 CDD:239730 37/173 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.