Sequence 1: | NP_724834.1 | Gene: | Prosalpha7 / 36018 | FlyBaseID: | FBgn0023175 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036100.3 | Gene: | Psmb2 / 26445 | MGIID: | 1347045 | Length: | 201 | Species: | Mus musculus |
Alignment Length: | 195 | Identity: | 45/195 - (23%) |
---|---|---|---|
Similarity: | 79/195 - (40%) | Gaps: | 39/195 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 VIGIRGKDAVVLAVEKIITSKLYE-PDAGGRIFTIEKNIGMAVAGLVADGNFVADIARQEAANYR 100
Fly 101 QQFEQAIPLKH---LCHRVAGYVHAYTLYSAVR---PFGLSIILASWDEVEGPQLY--------- 150
Fly 151 KIEPSGSSFGYFACASGKAKQLAKTEMEKLKMDMRTDELVESAGEIIYKVHDELKDKDFRFEMGL 215
Fly 216 215 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha7 | NP_724834.1 | proteasome_alpha_type_3 | 5..216 | CDD:239720 | 45/195 (23%) |
PRE1 | 6..231 | CDD:223711 | 45/195 (23%) | ||
Psmb2 | NP_036100.3 | proteasome_beta_type_2 | 1..192 | CDD:239727 | 45/195 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |