DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and Psmb2

DIOPT Version :10

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_036100.3 Gene:Psmb2 / 26445 MGIID:1347045 Length:201 Species:Mus musculus


Alignment Length:195 Identity:45/195 - (23%)
Similarity:79/195 - (40%) Gaps:39/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VIGIRGKDAVVLAVEKIITSKLYE-PDAGGRIFTIEKNIGMAVAGLVADGNFVADIARQEAANYR 100
            :|||:|.|.|::|.:::..|.:.: .|...::|.:.:.|.:...|...|        ..:.|.|.
Mouse     4 LIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGD--------TVQFAEYI 60

  Fly   101 QQFEQAIPLKH---LCHRVAGYVHAYTLYSAVR---PFGLSIILASWDEVEGPQLY--------- 150
            |:..|...:::   |....|.......|...:|   |:.::::||.:||.|||.||         
Mouse    61 QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALA 125

  Fly   151 KIEPSGSSFGYFACASGKAKQLAKTEMEKLKMDMRTDELVESAGEIIYKVHDELKDKDFRFEMGL 215
            |...:...:|.|...|...:....|...            |.|.|::.|..:||:.   ||.:.|
Mouse   126 KAPFAAHGYGAFLTLSILDRYYTPTISR------------ERAVELLRKCLEELQK---RFILNL 175

  Fly   216  215
            Mouse   176  175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 45/195 (23%)
Psmb2NP_036100.3 proteasome_beta_type_2 1..192 CDD:239727 45/195 (23%)

Return to query results.
Submit another query.