DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and Psmb2

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_036100.3 Gene:Psmb2 / 26445 MGIID:1347045 Length:201 Species:Mus musculus


Alignment Length:195 Identity:45/195 - (23%)
Similarity:79/195 - (40%) Gaps:39/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VIGIRGKDAVVLAVEKIITSKLYE-PDAGGRIFTIEKNIGMAVAGLVADGNFVADIARQEAANYR 100
            :|||:|.|.|::|.:::..|.:.: .|...::|.:.:.|.:...|...|        ..:.|.|.
Mouse     4 LIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGD--------TVQFAEYI 60

  Fly   101 QQFEQAIPLKH---LCHRVAGYVHAYTLYSAVR---PFGLSIILASWDEVEGPQLY--------- 150
            |:..|...:::   |....|.......|...:|   |:.::::||.:||.|||.||         
Mouse    61 QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALA 125

  Fly   151 KIEPSGSSFGYFACASGKAKQLAKTEMEKLKMDMRTDELVESAGEIIYKVHDELKDKDFRFEMGL 215
            |...:...:|.|...|...:....|...            |.|.|::.|..:||:.   ||.:.|
Mouse   126 KAPFAAHGYGAFLTLSILDRYYTPTISR------------ERAVELLRKCLEELQK---RFILNL 175

  Fly   216  215
            Mouse   176  175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 45/195 (23%)
PRE1 6..231 CDD:223711 45/195 (23%)
Psmb2NP_036100.3 proteasome_beta_type_2 1..192 CDD:239727 45/195 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.