DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and Psma4

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_036096.1 Gene:Psma4 / 26441 MGIID:1347060 Length:261 Species:Mus musculus


Alignment Length:252 Identity:73/252 - (28%)
Similarity:128/252 - (50%) Gaps:11/252 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLY-EPDAGGRIFTIE 71
            ||...:.|||:||::|::||.:|:..:||.:||...|.|:||.|:....||. |.....:|:.:.
Mouse     5 YDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLN 69

  Fly    72 KNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSI 136
            :::..:|||:.:|.|.:.:..|..|..|..|:::.||.:.|...:.....|||.:...||||:|:
Mouse    70 EDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSL 134

  Fly   137 ILASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEKLKMDMRTDEL-----VESAGEI 196
            :...||:..|.|||:.:|||:..|:.|...|.....|   :..||.|.:..|:     :..|.::
Mouse   135 LYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAA---VSMLKQDYKEGEMTLKSALALAVKV 196

  Fly   197 IYKVHDELKDKDFRFEMGLVGRVTGG--LHLINPSELTEKARKAGDAANKDEDSDNE 251
            :.|..|..|....:.|:..:.|.:|.  :.::...|:.:..:|..:...|.|....|
Mouse   197 LNKTMDVSKLSAEKVEIATLTRESGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 66/213 (31%)
PRE1 6..231 CDD:223711 68/230 (30%)
Psma4NP_036096.1 proteasome_alpha_type_4 3..216 CDD:239721 66/213 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.