DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and Psmb10

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_038668.2 Gene:Psmb10 / 19171 MGIID:1096380 Length:273 Species:Mus musculus


Alignment Length:230 Identity:55/230 - (23%)
Similarity:92/230 - (40%) Gaps:50/230 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KSGTVI-GIRGKDAVVLAV------EKIITSKLYEPDAGGRIFTIEKNIGMAVAGLVADGNFVAD 90
            |:||.| |:..:|.|:|..      :.::..|..|     :|..|...|....||:.||......
Mouse    37 KTGTTIAGLVFRDGVILGADTRATNDSVVADKSCE-----KIHFIAPKIYCCGAGVAADTEMTTR 96

  Fly    91 IARQE-----AANYRQQFEQAIP--LKHLCHRVAGYVHAYTLYSAVRPFGLSIILASWDEVEGPQ 148
            :|..:     .:..|:.....:.  |:....|..|:|            |.|:::...| :.|||
Mouse    97 MAASKMELHALSTGREPRVATVTRILRQTLFRYQGHV------------GASLVVGGVD-LNGPQ 148

  Fly   149 LYKIEPSG--SSFGYFACASGKAKQLAKTEMEKLKMDMRTDELVESAGEIIYKVHDELKDKDFRF 211
            ||::.|.|  |...:.|..||:...:|..| ::.:.:|    .:|:|.|::.    |........
Mouse   149 LYEVHPHGSYSRLPFTALGSGQGAAVALLE-DRFQPNM----TLEAAQELLV----EAITAGILS 204

  Fly   212 EMGLVGRV------TGGLHLINP-SELTEKARKAG 239
            ::|..|.|      .||..|... |..||..::||
Mouse   205 DLGSGGNVDACVITAGGAKLQRALSTPTEPVQRAG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 45/198 (23%)
PRE1 6..231 CDD:223711 51/220 (23%)
Psmb10NP_038668.2 20S_bact_beta 39..238 CDD:163402 52/225 (23%)
proteasome_beta_type_7 40..226 CDD:239732 48/212 (23%)
Pr_beta_C 232..267 CDD:289249 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.