DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and pas-1

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_506571.1 Gene:pas-1 / 179941 WormBaseID:WBGene00003922 Length:246 Species:Caenorhabditis elegans


Alignment Length:208 Identity:61/208 - (29%)
Similarity:116/208 - (55%) Gaps:7/208 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GYDLSASQFSPDGRVFQIDYASKAVEKSG-TVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTI 70
            |:|...:.|||:|||:|::||.||:..:. |.:.::|.||.|:||:|.:...|...|....::.|
 Worm     8 GFDRHITIFSPEGRVYQVEYAFKAINSTNLTAVAVKGADAAVIAVQKRVPDSLIVADTVTSVYQI 72

  Fly    71 EKNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLS 135
            .:::|....|::.|..|....|:.|||:::.:....:|.:.|..::|.....||..:.:|..|.:
 Worm    73 SQSVGCCAIGMIPDAKFQIKRAQGEAASWKYKNGYDMPCELLAKKMADLNQYYTQNAEMRSLGCA 137

  Fly   136 IILASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTE-ME---KLKMDMRTDELVESAGEI 196
            ::..|:|:.:||::|:::|:|...|....:.| .|||..|. :|   |.|.::.:.|.:|.|.|.
 Worm   138 LLFISYDDEKGPEVYRVDPAGYYRGMKGVSVG-VKQLPATSFLEKKIKKKSELTSTEAIELAIEA 201

  Fly   197 IY-KVHDELKDKD 208
            :. .:..:::.||
 Worm   202 LQTSLGIDVRSKD 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 61/208 (29%)
PRE1 6..231 CDD:223711 61/208 (29%)
pas-1NP_506571.1 PRE1 7..245 CDD:223711 61/208 (29%)
proteasome_alpha_type_6 8..220 CDD:239723 61/208 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.