DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and pbs-6

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_498806.1 Gene:pbs-6 / 176161 WormBaseID:WBGene00003952 Length:258 Species:Caenorhabditis elegans


Alignment Length:160 Identity:34/160 - (21%)
Similarity:63/160 - (39%) Gaps:21/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ASKAVEK---------SGTVIGIRGKDAVVLAVEKIITS---KLYEPDAGGRIFTIEKNIGMAVA 79
            :|:.:|:         .|:...|.|::..::|.:..:|.   .:...|| .:|..:..||.:..:
 Worm    35 SSRQIERQRWNPYSMEGGSTCAISGENFAIVASDTRMTQNDINILTRDA-EKIQILNDNIILTTS 98

  Fly    80 GLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSIILASWDEV 144
            |...|...:..:.:.....||..:...:.: .||   |..:.....|....|:....|||..||.
 Worm    99 GFYGDVLQLKKVLQSRLHKYRFDYRSDMSV-DLC---AELLSRNLYYRRFFPYYTGAILAGIDEH 159

  Fly   145 EGPQLYKIEPSG--SSFGYFACASGKAKQL 172
            ....::..:|.|  ...||  .|||.|:.:
 Worm   160 GKGAVFSYDPIGCIERLGY--SASGAAEPM 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 34/160 (21%)
PRE1 6..231 CDD:223711 34/160 (21%)
pbs-6NP_498806.1 PRE1 38..246 CDD:223711 33/157 (21%)
Ntn_hydrolase 44..258 CDD:294319 32/151 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.