DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and pbs-3

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_494913.1 Gene:pbs-3 / 173858 WormBaseID:WBGene00003949 Length:204 Species:Caenorhabditis elegans


Alignment Length:217 Identity:41/217 - (18%)
Similarity:75/217 - (34%) Gaps:76/217 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GTVIGIRGKDAVVLAVE---------------KI--ITSKLYEPDAGGRIFTIEKNIGMAVAGLV 82
            |||:.:.|.:.|.:|.:               |:  :|.|:|                :.:||..
 Worm     9 GTVVAMAGDECVCIASDLRIGEQMTTIATDQKKVHKVTDKVY----------------VGLAGFQ 57

  Fly    83 ADGNFVAD--------IARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSIILA 139
            :|...|.:        ...:|..|.:.|.     |..:...:| |.|.:..| ...|     ::|
 Worm    58 SDARTVLEKIMFRKNLYELRENRNIKPQV-----LSEMISNLA-YQHRFGSY-FTEP-----LVA 110

  Fly   140 SWDEVEGPQLYKIEPSG---SSFGYFACASGKAKQLAKTEMEKLKMDMRTDELVESA-------- 193
            ..|:...|.:..::..|   :...:.|..:|:...|...| ...:.:|:.|||.|:.        
 Worm   111 GLDDTNKPYICCMDTIGCVSAPRDFVAVGTGQEYLLGVCE-NFWRENMKPDELFEATAQSILSCL 174

  Fly   194 --------GEIIYKVHDELKDK 207
                    |.::|.:   .|||
 Worm   175 ERDAASGWGAVVYTI---TKDK 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 41/217 (19%)
PRE1 6..231 CDD:223711 41/217 (19%)
pbs-3NP_494913.1 PRE1 3..193 CDD:223711 39/215 (18%)
proteasome_beta_type_3 6..200 CDD:239728 41/217 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.