DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and pbs-2

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_493271.1 Gene:pbs-2 / 173168 WormBaseID:WBGene00003948 Length:277 Species:Caenorhabditis elegans


Alignment Length:261 Identity:57/261 - (21%)
Similarity:84/261 - (32%) Gaps:90/261 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ASKAVEKSGTVIGIRGKDAVVLAV---------------EKI--ITSKLYEPDAG---------- 64
            |.|......|::.:..|..:|:..               ||:  :|..:|...||          
 Worm    39 APKLTSTGTTIVAVAFKGGLVMGADSRATAGNIIADKHCEKVHKLTESIYACGAGTAADLDQVTK 103

  Fly    65 ---GRIFTIEKNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLY 126
               |.:..:|.|.|.....:.|     ...|:|...||:                 ||:.||.|.
 Worm   104 MLSGNLRLLELNTGRKARVITA-----LRQAKQHLFNYQ-----------------GYIGAYLLI 146

  Fly   127 SAVRPFGLSIILASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEK-LKMDMRTDE-- 188
            ..|.|             .||.||....:|::..:...|.|.....|.|.:|: .|:||..||  
 Worm   147 GGVDP-------------TGPHLYMCSANGTTMAFPFTAQGSGSYAAITILERDFKVDMTKDEAE 198

  Fly   189 -LVESAGEIIYKVHDELKDKDFRFEMGLVGRVTGG----LHLINPSELTEKARKAGDAANKDEDS 248
             ||:.|                 .|.|:.|....|    |.:|.|||...|.....:...:.|.:
 Worm   199 KLVQRA-----------------LEAGMHGDNASGNSLNLVIIEPSETVFKGPIVPEFCKRPEPN 246

  Fly   249 D 249
            |
 Worm   247 D 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 47/222 (21%)
PRE1 6..231 CDD:223711 53/241 (22%)
pbs-2NP_493271.1 PRE1 43..228 CDD:223711 50/236 (21%)
proteasome_beta_type_7 47..235 CDD:239732 53/239 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.