DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and psma6a

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_705941.2 Gene:psma6a / 171585 ZFINID:ZDB-GENE-020326-1 Length:246 Species:Danio rerio


Alignment Length:239 Identity:79/239 - (33%)
Similarity:129/239 - (53%) Gaps:12/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GYDLSASQFSPDGRVFQIDYASKAVEKSG-TVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTI 70
            |:|...:.|||:||::|::||.||:.:.| |.:.:||||..|:..::.:..||.:......:|.|
Zfish     8 GFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVITQRKVPDKLLDSSTVTHLFRI 72

  Fly    71 EKNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLS 135
            .:|||..::|:.||.......||.||||::.::...||:..||.|:|.....||..:.:||.|..
Zfish    73 TENIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCC 137

  Fly   136 IILASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEME---KLKMDMRTDELVESAGEII 197
            :|:...||..|||:||.:|:|...|:.|.|:|..:..|.:.:|   |.|:|...|:.||:|...:
Zfish   138 MIVVGVDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKIKKKLDWTFDQTVETAISCL 202

  Fly   198 YKVHDELKDKDFRFEMGLVGRVTGGLHLINPSE-------LTEK 234
            ..|. .:..|....|:|:|........:::.||       |||:
Zfish   203 STVL-AIDFKPSELEIGVVTTEEPKFRILSESEIDTHLMALTER 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 73/212 (34%)
PRE1 6..231 CDD:223711 76/234 (32%)
psma6aNP_705941.2 PRK03996 6..239 CDD:235192 76/231 (33%)
proteasome_alpha_type_6 8..220 CDD:239723 73/212 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.