Sequence 1: | NP_724834.1 | Gene: | Prosalpha7 / 36018 | FlyBaseID: | FBgn0023175 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_653263.2 | Gene: | PSMA8 / 143471 | HGNCID: | 22985 | Length: | 256 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 66/196 - (33%) |
---|---|---|---|
Similarity: | 110/196 - (56%) | Gaps: | 10/196 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTIEK 72
Fly 73 NIGMAVA------GLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRP 131
Fly 132 FGLSIILASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEKLKMDMRTDELVESAGEI 196
Fly 197 I 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha7 | NP_724834.1 | proteasome_alpha_type_3 | 5..216 | CDD:239720 | 66/196 (34%) |
PRE1 | 6..231 | CDD:223711 | 66/196 (34%) | ||
PSMA8 | NP_653263.2 | PRK03996 | 5..237 | CDD:235192 | 66/196 (34%) |
proteasome_alpha_type_7 | 5..219 | CDD:239724 | 66/196 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1222564at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |