DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and PSMB11

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001093250.1 Gene:PSMB11 / 122706 HGNCID:31963 Length:300 Species:Homo sapiens


Alignment Length:162 Identity:31/162 - (19%)
Similarity:65/162 - (40%) Gaps:21/162 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TVIGIRGKDAVVLAVEKIITSKLYEP-DAGGRIFTIEKNIGMAVAGLVADGNFVADIARQEAANY 99
            |.:..|.:..|:.|.:...:...|.. .|..::..:.:::....:|..||           .|.:
Human    51 TTLAFRFRHGVIAAADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSAD-----------CATW 104

  Fly   100 RQQFEQAIPLKHLCH-RVAGYVHAYTLYSAV--RPFGLSIILAS----WDEVEGPQLYKIEPSGS 157
            .:..::.:.|:.|.. ::.....|..|.||:  :..||.:.:|:    ||. .||:|:.:...|:
Human   105 YRVLQRELRLRELREGQLPSVASAAKLLSAMMSQYRGLDLCVATALCGWDR-SGPELFYVYSDGT 168

  Fly   158 SFGYFACASGKAKQLAKTEMEK-LKMDMRTDE 188
            .......:.|.....|...::: .:.||.|.|
Human   169 RLQGDIFSVGSGSPYAYGVLDRGYRYDMSTQE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 31/162 (19%)
PRE1 6..231 CDD:223711 31/162 (19%)
PSMB11NP_001093250.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
proteasome_beta_type_5 50..237 CDD:239730 31/162 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.