DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and AT4G15165

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001190735.1 Gene:AT4G15165 / 10723067 AraportID:AT4G15165 Length:208 Species:Arabidopsis thaliana


Alignment Length:237 Identity:67/237 - (28%)
Similarity:111/237 - (46%) Gaps:47/237 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAG-GRIFTIE 71
            ||...:.|||:||::|::||.:|:..:|:.|||..||.|||..||.:||||.:..:. .:::.|:
plant     5 YDSRTTIFSPEGRLYQVEYAMEAIGNAGSAIGILAKDGVVLVGEKKVTSKLLQTSSSMEKMYKID 69

  Fly    72 KNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSI 136
            .::..||||:::|.|.:.:.||.:|..                                      
plant    70 DHVACAVAGIMSDANILINTARVQAQR-------------------------------------- 96

  Fly   137 ILASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEK-LKMDMRTDELVESAGEIIYKV 200
                ||...|.|||..:|||:..|:.|.|.|...|.|::.::: .|.|...:|:|:.|.:::.|.
plant    97 ----WDRNHGFQLYMSDPSGNYGGWQAAAVGANNQAAQSILKQDYKDDATREEVVQLAIKVLSKT 157

  Fly   201 HDELK---DKDFRFEMGLVGRVTGGLHLINPSELTEKARKAG 239
            .|...   :|....|:.|........|:.:|..||:...|.|
plant   158 MDSTSLTAEKLELAELYLTPSKCVKYHVHSPDSLTKLLVKHG 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 60/212 (28%)
PRE1 6..231 CDD:223711 63/227 (28%)
AT4G15165NP_001190735.1 Ntn_hydrolase 3..173 CDD:382028 59/209 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.