DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and psmb11b

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001268731.1 Gene:psmb11b / 100331481 ZFINID:ZDB-GENE-170530-2 Length:362 Species:Danio rerio


Alignment Length:40 Identity:15/40 - (37%)
Similarity:20/40 - (50%) Gaps:10/40 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 TGGL-----HLINP---SELTEKARKAGDAANKDEDSDNE 251
            |||.     |:::|   :||...|...|  .:.|||.|||
Zfish   185 TGGAAKLLSHMLHPFKGTELCVAATLCG--WDGDEDQDNE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720
PRE1 6..231 CDD:223711 5/18 (28%)
psmb11bNP_001268731.1 proteasome_beta_type_5 110..333 CDD:239730 15/40 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.