DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Orc6 and ORC6

DIOPT Version :9

Sequence 1:NP_477319.1 Gene:Orc6 / 36017 FlyBaseID:FBgn0023180 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_174006.2 Gene:ORC6 / 839227 AraportID:AT1G26840 Length:977 Species:Arabidopsis thaliana


Alignment Length:282 Identity:63/282 - (22%)
Similarity:121/282 - (42%) Gaps:34/282 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IEQLITKMGLREEPNVLEKTTELVRLLELRSTNVPLQINEYGKIVLCADLASCMIGIAFDKEQAL 69
            |..:..|:.|.....::.|..|:.||.:.:..:..:.:.|..|.|:|.::|:..:.|.||::.|:
plant     3 ISDIGRKLSLDNNKLLIRKAAEIRRLCDAQFDSSIIGVGEICKAVICLEIAATRLQIIFDRQAAV 67

  Fly    70 KLSGLRKSQYLNNKRMFEKLLDLNKLASVNDICVQLGLNEVARKAEELMTLFK-----GVAATED 129
            ||||:.:..|..:....:.::.:....:|.::.||.|...|.:..:.:::.:|     .:.|:..
plant    68 KLSGMSEKAYSRSFNSLQNVIGIKIKLNVRELAVQFGCVRVIKSVQNVLSSYKERFLASLPASRR 132

  Fly   130 MGTDTSHPQYATMAVFQACRLLKKKVSKSKLMPFSNLRPSQFQLLEQQWERM------IAKHHKE 188
            ...|.:.|.:...|.:...:..|.||.|.:|:.......|:|..:......:      |:|..|:
plant   133 ANADFTRPVFTAAAFYLCAKKQKLKVDKLRLIEVCGTSESEFSCVSTSMTDLCFDCVGISKEKKD 197

  Fly   189 SK-VPSSTD----MEGKLKENQNENIKGHEAK--KAHKPPPE-DYEIWKARMLAK---------- 235
            :| |..:.|    :.||.:........|.|:.  |.||...| .||.||:.::..          
plant   198 AKDVKGNRDLLDVLPGKRRLEDGGYSSGDESSCYKRHKKMEEAKYEDWKSTVVNSIKKNPEKGTK 262

  Fly   236 --AQAKL---KELEASQSHMDS 252
              .||.|   |:.|..:..:||
plant   263 RVIQASLNFPKKSETKELQVDS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Orc6NP_477319.1 Orc6_mid 5..>94 CDD:304498 21/88 (24%)
Orc6_mid 97..185 CDD:211425 18/98 (18%)
ORC6_CTD 187..242 CDD:293922 19/77 (25%)
ORC6NP_174006.2 ORC6 3..>92 CDD:283186 21/88 (24%)
Orc6_mid 93..187 CDD:211425 17/93 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 43 1.000 Domainoid score I4753
eggNOG 1 0.900 - - E1_KOG4557
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I2441
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522235at2759
OrthoFinder 1 1.000 - - FOG0006558
OrthoInspector 1 1.000 - - oto2836
orthoMCL 1 0.900 - - OOG6_106334
Panther 1 1.100 - - LDO PTHR13394
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.