DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Orc6 and Orc6

DIOPT Version :9

Sequence 1:NP_477319.1 Gene:Orc6 / 36017 FlyBaseID:FBgn0023180 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_062690.2 Gene:Orc6 / 56452 MGIID:1929285 Length:262 Species:Mus musculus


Alignment Length:260 Identity:77/260 - (29%)
Similarity:131/260 - (50%) Gaps:23/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIEQLITKMGLREEPNVLEKTTELVRLLELRSTNVPLQINEYGKIVLCADLASCMIGIAFDKEQA 68
            |:.:|..::|| .||:||.|..|.:||.:::..::..:.:|....|:|.|||:.......|:...
Mouse     5 LVRRLAPRLGL-AEPSVLRKAEEFLRLSKVKCVSLSARSSETSNAVICLDLAASCRKCPLDRAYL 68

  Fly    69 LKLSGLRKSQYLNNKRMFEKLLDLNKLASVNDICVQLGLNEVARKAEELMTLFK-GVAATEDMGT 132
            ::||||.|..|.:..:.||.||.||....:.|:.||....|....|.|::..:: |:..|:....
Mouse    69 IRLSGLNKMVYQSCLKSFECLLGLNSNVGIRDLAVQFSCTEAVNLAAEILQSYESGLPETQRADL 133

  Fly   133 DTSHPQYATMAVFQACRLLKKKVSKSKLMPFSNLRPSQFQLLEQQWERMIAKHHKESKVPSSTDM 197
            |.|.|.:.|.|:..||::||.||.|:|::..|.::.:....|.:|.|::..:.:::|...:...:
Mouse   134 DLSRPLFTTAALLSACKILKIKVDKTKMITASGVKKAILDRLCKQLEKIGQQINRDSADLARPAL 198

  Fly   198 EGKLKENQNENIKGHE------AKK------AHKPP-----PEDYEIWKARML---AKAQAKLKE 242
            :.| |...:..:|..|      ||:      .||.|     .:|||.||.::|   ||||....|
Mouse   199 KRK-KPEFSPTLKKKEPGLEPPAKEIEVIETLHKLPKDEDLTQDYEEWKRKILENAAKAQTATAE 262

  Fly   243  242
            Mouse   263  262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Orc6NP_477319.1 Orc6_mid 5..>94 CDD:304498 29/88 (33%)
Orc6_mid 97..185 CDD:211425 25/88 (28%)
ORC6_CTD 187..242 CDD:293922 20/74 (27%)
Orc6NP_062690.2 ORC6 6..>94 CDD:283186 28/87 (32%)
Orc6_mid 94..186 CDD:211425 26/92 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..217 5/25 (20%)
ORC6_CTD 211..259 CDD:293922 18/53 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836470
Domainoid 1 1.000 53 1.000 Domainoid score I11327
eggNOG 1 0.900 - - E1_KOG4557
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I4921
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45287
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006558
OrthoInspector 1 1.000 - - oto93020
orthoMCL 1 0.900 - - OOG6_106334
Panther 1 1.100 - - LDO PTHR13394
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4705
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.