DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Orc6 and ORC6

DIOPT Version :9

Sequence 1:NP_477319.1 Gene:Orc6 / 36017 FlyBaseID:FBgn0023180 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_055136.1 Gene:ORC6 / 23594 HGNCID:17151 Length:252 Species:Homo sapiens


Alignment Length:250 Identity:70/250 - (28%)
Similarity:121/250 - (48%) Gaps:18/250 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIEQLITKMGLREEPNVLEKTTELVRLLELRSTNVPLQINEYGKIVLCADLASCMIGIAFDKEQA 68
            ||.:|..::|| .||::|.|..|.:||..::...:..:..|....|:|.|||:..:....|:...
Human     5 LIGRLAPRLGL-AEPDMLRKAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYL 68

  Fly    69 LKLSGLRKSQYLNNKRMFEKLLDLNKLASVNDICVQLGLNEVARKAEELMTLFK-GVAATEDMGT 132
            :|||||.|..|.:..:.||.||.||....:.|:.||....|....|.:::..:: .:..|:.:..
Human    69 IKLSGLNKETYQSCLKSFECLLGLNSNIGIRDLAVQFSCIEAVNMASKILKSYESSLPQTQQVDL 133

  Fly   133 DTSHPQYATMAVFQACRLLKKKVSKSKLMPFSNLRPSQFQLLEQQWER-----------MIAKHH 186
            |.|.|.:.:.|:..||::||.||.|:|::..|.::.:.|..|.:|.|:           :.....
Human   134 DLSRPLFTSAALLSACKILKLKVDKNKMVATSGVKKAIFDRLCKQLEKIGQQVDREPGDVATPPR 198

  Fly   187 KESKVPSSTDMEGKLKENQNENIKGHEAKKAHKPPPEDYEIWKARMLAKAQAKLK 241
            |..|:.    :|...||.:......|:.:| .:...:|||.||.::|..|.:..|
Human   199 KRKKIV----VEAPAKEMEKVEEMPHKPQK-DEDLTQDYEEWKRKILENAASAQK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Orc6NP_477319.1 Orc6_mid 5..>94 CDD:304498 30/88 (34%)
Orc6_mid 97..185 CDD:211425 23/99 (23%)
ORC6_CTD 187..242 CDD:293922 14/54 (26%)
ORC6NP_055136.1 ORC6 6..>94 CDD:310218 30/88 (34%)
Orc6_mid 94..186 CDD:211425 23/91 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..232 7/48 (15%)
ORC6_CTD 199..249 CDD:293922 14/54 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146390
Domainoid 1 1.000 53 1.000 Domainoid score I11389
eggNOG 1 0.900 - - E1_KOG4557
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4957
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45287
OrthoDB 1 1.010 - - D1522235at2759
OrthoFinder 1 1.000 - - FOG0006558
OrthoInspector 1 1.000 - - oto89449
orthoMCL 1 0.900 - - OOG6_106334
Panther 1 1.100 - - LDO PTHR13394
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4705
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.