Sequence 1: | NP_001286256.1 | Gene: | Sting / 36016 | FlyBaseID: | FBgn0033453 | Length: | 343 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_938023.1 | Gene: | STING1 / 340061 | HGNCID: | 27962 | Length: | 379 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 56/206 - (27%) |
---|---|---|---|
Similarity: | 105/206 - (50%) | Gaps: | 33/206 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 151 AAGMASNYFHGYLKLSLPERKDDGLKHRLAMY-EDKNNVTFGI--KRLVILIPDEMFVNGVLESH 212
Fly 213 LLDKAEP-------LETQFINRAGVY-RPFKHDVYRMNKKVNG-RTYYFAVEGATPMISFFDATY 268
Fly 269 SNLSGTWQMQELKREIWIKFYKHLKELITTWPETRDLVELIIYN--SHDSKGNLVDVGELLVAHM 331
Fly 332 QNKTKTIDEIS 342 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sting | NP_001286256.1 | TMEM173 | 33..335 | CDD:291670 | 54/197 (27%) |
STING1 | NP_938023.1 | Mediates interaction with ZDHHC1 and ZDHHC11. /evidence=ECO:0000269|PubMed:25299331, ECO:0000269|PubMed:28331227 | 1..190 | 16/38 (42%) | |
TMEM173 | 44..337 | CDD:317429 | 54/197 (27%) | ||
Cyclic dinucleotide-binding domain (CBD). /evidence=ECO:0000269|PubMed:22705373 | 153..340 | 55/202 (27%) | |||
c-di-GMP binding. /evidence=ECO:0000269|PubMed:22728658, ECO:0000269|PubMed:22728659, ECO:0000269|PubMed:22728660, ECO:0007744|PDB:4EMT, ECO:0007744|PDB:4F5D, ECO:0007744|PDB:4F5Y | 238..241 | 1/2 (50%) | |||
C-terminal tail (CTT). /evidence=ECO:0000269|PubMed:22705373 | 340..379 | 1/3 (33%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 341..370 | 0/2 (0%) | |||
pLxIS motif. /evidence=ECO:0000269|PubMed:25636800 | 363..366 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165144856 | |
Domainoid | 1 | 1.000 | 41 | 1.000 | Domainoid score | I12519 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D371197at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0008120 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_110638 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR34339 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.850 |