DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sting and STING1

DIOPT Version :9

Sequence 1:NP_001286256.1 Gene:Sting / 36016 FlyBaseID:FBgn0033453 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_938023.1 Gene:STING1 / 340061 HGNCID:27962 Length:379 Species:Homo sapiens


Alignment Length:206 Identity:56/206 - (27%)
Similarity:105/206 - (50%) Gaps:33/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 AAGMASNYFHGYLKLSLPERKDDGLKHRLAMY-EDKNNVTFGI--KRLVILIPDEMFVNGVLESH 212
            |.|:|.:|:.|||:|.|||     |:.|:..| :..||:..|.  :||.||:|.:.   ||.:: 
Human   156 AHGLAWSYYIGYLRLILPE-----LQARIRTYNQHYNNLLRGAVSQRLYILLPLDC---GVPDN- 211

  Fly   213 LLDKAEP-------LETQFINRAGVY-RPFKHDVYRMNKKVNG-RTYYFAVEGATPMISFFDATY 268
             |..|:|       |..|..:.||:. |.:.:.:|.:.:  || |.....:|.|||:.:.|..:.
Human   212 -LSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLE--NGQRAGTCVLEYATPLQTLFAMSQ 273

  Fly   269 SNLSGTWQMQELKREIWIKFYKHLKELITTWPETRDLVELIIYN--SHDSKGNLVDVGELLVAHM 331
            .:.:|..:...|::.  ..|.:.|::::...||:::...||.|.  :.||..:|   .:.::.|:
Human   274 YSQAGFSREDRLEQA--KLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSL---SQEVLRHL 333

  Fly   332 QNKTKTIDEIS 342
            :.:.|  :|::
Human   334 RQEEK--EEVT 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StingNP_001286256.1 TMEM173 33..335 CDD:291670 54/197 (27%)
STING1NP_938023.1 Mediates interaction with ZDHHC1 and ZDHHC11. /evidence=ECO:0000269|PubMed:25299331, ECO:0000269|PubMed:28331227 1..190 16/38 (42%)
TMEM173 44..337 CDD:317429 54/197 (27%)
Cyclic dinucleotide-binding domain (CBD). /evidence=ECO:0000269|PubMed:22705373 153..340 55/202 (27%)
c-di-GMP binding. /evidence=ECO:0000269|PubMed:22728658, ECO:0000269|PubMed:22728659, ECO:0000269|PubMed:22728660, ECO:0007744|PDB:4EMT, ECO:0007744|PDB:4F5D, ECO:0007744|PDB:4F5Y 238..241 1/2 (50%)
C-terminal tail (CTT). /evidence=ECO:0000269|PubMed:22705373 340..379 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..370 0/2 (0%)
pLxIS motif. /evidence=ECO:0000269|PubMed:25636800 363..366
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144856
Domainoid 1 1.000 41 1.000 Domainoid score I12519
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D371197at33208
OrthoFinder 1 1.000 - - FOG0008120
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110638
Panther 1 1.100 - - LDO PTHR34339
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.