DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sting and sting1

DIOPT Version :9

Sequence 1:NP_001286256.1 Gene:Sting / 36016 FlyBaseID:FBgn0033453 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001265766.1 Gene:sting1 / 101243556 ZFINID:ZDB-GENE-120921-1 Length:398 Species:Danio rerio


Alignment Length:181 Identity:46/181 - (25%)
Similarity:88/181 - (48%) Gaps:28/181 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 IRDSHGLDYAAGMASNYFHGYLKLSLPERKDDGLKHRLAMYEDKNNVTFGIKRLVILI------- 199
            |.::..::.|.|:|.:::.||||..||     .|:..:..|..:..::  ..||.||:       
Zfish   144 ICEAKKMNVAHGLAWSFYIGYLKFLLP-----ALEVNVREYSRRERLS--SPRLHILLPLNARVP 201

  Fly   200 --PDEMFVNGVLESHLLDKAEPLETQFINRAGV-YRPFKHDVYRMNKKVNGRTYYFAVEGATPMI 261
              |.|...|.|...:|.|..       ::|||| .|.:.:.||::..  |..|:...:|.|||::
Zfish   202 SKPGEEDTNVVFHENLPDLK-------LDRAGVRKRSYTNSVYKITH--NNETFSCILEYATPLL 257

  Fly   262 SFFDATYSNLSGTWQMQELKREIWIKFYKHLKELITTWPETRDLVELIIYN 312
            :.:..:..:.:|..: :|.|::: :.||:.|.:::....|.|:...||:.|
Zfish   258 TLYQMSQESSAGFGE-RERKQQV-LLFYRTLSQILDNSLECRNRYRLILLN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StingNP_001286256.1 TMEM173 33..335 CDD:291670 46/181 (25%)
sting1NP_001265766.1 TMEM173 42..328 CDD:291670 46/181 (25%)
Cyclic dinucleotide-binding domain (CBD). /evidence=ECO:0000250|UniProtKB:Q86WV6 150..331 45/175 (26%)
c-di-GMP binding. /evidence=ECO:0000250|UniProtKB:Q86WV6 230..233 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 375..398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578066
Domainoid 1 1.000 47 1.000 Domainoid score I12068
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D371197at33208
OrthoFinder 1 1.000 - - FOG0008120
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110638
Panther 1 1.100 - - LDO PTHR34339
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.