DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and VAMP3

DIOPT Version :10

Sequence 1:NP_610524.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_004772.1 Gene:VAMP3 / 9341 HGNCID:12644 Length:100 Species:Homo sapiens


Alignment Length:81 Identity:23/81 - (28%)
Similarity:49/81 - (60%) Gaps:1/81 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 ISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASRNLARQMFWKNIRVY 190
            :.:...|:||:.|||..|:|.:.:|.:||..|.::.:.|...:..|..::..|.|:.:|||.:::
Human    15 LQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMW 79

  Fly   191 VV-VGLVITFIVYVIV 205
            .: :.:::.||:.:||
Human    80 AIGITVLVIFIIIIIV 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_610524.1 Longin 4..117 CDD:341428
R-SNARE_VAMP7 124..188 CDD:277224 19/61 (31%)
VAMP3NP_004772.1 R-SNARE_VAMP2 13..75 CDD:277223 17/59 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.