DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and SEC22C

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_116752.1 Gene:SEC22C / 9117 HGNCID:16828 Length:303 Species:Homo sapiens


Alignment Length:96 Identity:22/96 - (22%)
Similarity:40/96 - (41%) Gaps:13/96 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DYLIHYTCENKLVYMCITDNEFERSRAFLFLADIKQKFIQTYGLQVATAIAYSMN----TEFSKI 109
            |:.||::....:..|.|...:...:.||.||..:..:|..:|.   .|.|..:..    .||..|
Human    57 DFSIHFSSFGDVACMAICSCQCPAAMAFCFLETLWWEFTASYD---TTCIGLASRPYAFLEFDSI 118

  Fly   110 LAQ---QMVYFSQSREVDTISRVHGQIDELK 137
            :.:   ...|.|.|:...::.::.   :|||
Human   119 IQKVKWHFNYVSSSQMECSLEKIQ---EELK 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490 11/47 (23%)
Synaptobrevin 122..210 CDD:279324 3/16 (19%)
R-SNARE_VAMP7 124..188 CDD:277224 3/14 (21%)
SEC22CNP_116752.1 Longin 42..114 CDD:316307 13/59 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.