DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and VAMP8

DIOPT Version :10

Sequence 1:NP_610524.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_003752.2 Gene:VAMP8 / 8673 HGNCID:12647 Length:100 Species:Homo sapiens


Alignment Length:90 Identity:30/90 - (33%)
Similarity:57/90 - (63%) Gaps:0/90 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 DTISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASRNLARQMFWKNIR 188
            |.:..:..:::.:|:||.:|::.:..|||.||.|.||||:|...|..|:..|:.:||:.:|||::
Human    11 DRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVK 75

  Fly   189 VYVVVGLVITFIVYVIVSMACGGLA 213
            :.|::.:::..|:..||..|.|..:
Human    76 MIVLICVIVFIIILFIVLFATGAFS 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_610524.1 Longin 4..117 CDD:341428
R-SNARE_VAMP7 124..188 CDD:277224 24/63 (38%)
VAMP8NP_003752.2 R-SNARE_VAMP8 10..77 CDD:277221 24/65 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.