powered by:
Protein Alignment Vamp7 and SNC2
DIOPT Version :9
Sequence 1: | NP_001286255.1 |
Gene: | Vamp7 / 36015 |
FlyBaseID: | FBgn0266186 |
Length: | 218 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_014972.3 |
Gene: | SNC2 / 854505 |
SGDID: | S000005854 |
Length: | 115 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 74 |
Identity: | 22/74 - (29%) |
Similarity: | 50/74 - (67%) |
Gaps: | 0/74 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 132 QIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASRNLARQMFWKNIRVYVVVGLV 196
:||:...||..||:.:.:|||:|..:.:|.:||:.::..|::.:..:.:||:||::::.:.:.||
Yeast 34 EIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWWKDLKMRMCLFLV 98
Fly 197 ITFIVYVIV 205
:..::.||:
Yeast 99 VIILLVVII 107
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5143 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.