DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and SNC2

DIOPT Version :10

Sequence 1:NP_610524.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_014972.3 Gene:SNC2 / 854505 SGDID:S000005854 Length:115 Species:Saccharomyces cerevisiae


Alignment Length:74 Identity:22/74 - (29%)
Similarity:50/74 - (67%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 QIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASRNLARQMFWKNIRVYVVVGLV 196
            :||:...||..||:.:.:|||:|..:.:|.:||:.::..|::.:..:.:||:||::::.:.:.||
Yeast    34 EIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWWKDLKMRMCLFLV 98

  Fly   197 ITFIVYVIV 205
            :..::.||:
Yeast    99 VIILLVVII 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_610524.1 Longin 4..117 CDD:341428
R-SNARE_VAMP7 124..188 CDD:277224 18/55 (33%)
SNC2NP_014972.3 SNC1 <1..96 CDD:227472 18/61 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.