DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and SNC1

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_009372.1 Gene:SNC1 / 851203 SGDID:S000000028 Length:117 Species:Saccharomyces cerevisiae


Alignment Length:88 Identity:24/88 - (27%)
Similarity:55/88 - (62%) Gaps:4/88 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 SQSREVDTISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASRNLARQM 182
            |:||..:    :..:||:...||..||:.:.:|||:|..:.:|.:||:.::..|::.:..:.:.|
Yeast    25 SKSRTAE----LQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAM 85

  Fly   183 FWKNIRVYVVVGLVITFIVYVIV 205
            ::|::::.:.:.|||..::.||:
Yeast    86 WYKDLKMKMCLALVIIILLVVII 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490
Synaptobrevin 122..210 CDD:279324 21/84 (25%)
R-SNARE_VAMP7 124..188 CDD:277224 16/63 (25%)
SNC1NP_009372.1 SNC1 <1..117 CDD:227472 24/88 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.