DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and SEC22

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_013370.1 Gene:SEC22 / 850973 SGDID:S000004258 Length:214 Species:Saccharomyces cerevisiae


Alignment Length:162 Identity:40/162 - (24%)
Similarity:79/162 - (48%) Gaps:6/162 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TYTHGDYLIHYTCENKLVYMCITDNEFERSRAFLFLADIKQKFIQTYGLQV--ATAIAYSMNTEF 106
            |...|.:.|||..::.:.|..|.::.:.|:.||.:|.||.|:|..::..:.  .|...|.. ..|
Yeast    50 TLESGSFEIHYLKKSMVYYFVICESGYPRNLAFSYLNDIAQEFEHSFANEYPKPTVRPYQF-VNF 113

  Fly   107 SKILAQQMVYFSQSREVDTISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAF 171
            ...|......:|..:..|.:.:::.::..:|.||.|||:.|..||:.|:.:.:.:.:|...|..:
Yeast   114 DNFLQMTKKSYSDKKVQDNLDQLNQELVGVKQIMSKNIEDLLYRGDSLDKMSDMSSSLKETSKRY 178

  Fly   172 RKASRNLARQMFWKNIRVYVVVGLVITFIVYV 203
            ||:::.:...:.   |..|..:.:|..|.|::
Yeast   179 RKSAQKINFDLL---ISQYAPIVIVAFFFVFL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490 15/54 (28%)
Synaptobrevin 122..210 CDD:279324 20/82 (24%)
R-SNARE_VAMP7 124..188 CDD:277224 15/63 (24%)
SEC22NP_013370.1 SNC1 2..192 CDD:227472 35/145 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53513
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.