DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and VAMP721

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_171967.1 Gene:VAMP721 / 839419 AraportID:AT1G04750 Length:219 Species:Arabidopsis thaliana


Alignment Length:211 Identity:68/211 - (32%)
Similarity:119/211 - (56%) Gaps:2/211 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILYSVISRGTTVLAKFAECVGNFAEVTEHIIGRIGVHNHKMTYTHGDYLIHYTCENKLVYMCITD 67
            ::||.::|||.:|.:|.:..|||..:....:.::...|:|.||....:..:|..|:...|..:..
plant     6 LIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVEDGFTYCVVAV 70

  Fly    68 NEFERSRAFLFLADIKQKFIQTY-GLQVATAIAYSMNTEFSKILAQQMVY-FSQSREVDTISRVH 130
            :...|.....||..:|:.|.:.| |.:.|||.|.|:|.||...|.:.|.| .....|:..:::|.
plant    71 DSAGRQIPMSFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDHPDEISKLAKVK 135

  Fly   131 GQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASRNLARQMFWKNIRVYVVVGL 195
            .|:.|:|.:|::||:.:.|||||:||||:|||||.:.:..||.....:.|:|:.:|:::.::|..
plant   136 AQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMRRKMWLQNMKIKLIVLA 200

  Fly   196 VITFIVYVIVSMACGG 211
            :|..::.:||...|.|
plant   201 IIIALILIIVLSVCHG 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490 15/65 (23%)
Synaptobrevin 122..210 CDD:279324 31/87 (36%)
R-SNARE_VAMP7 124..188 CDD:277224 26/63 (41%)
VAMP721NP_171967.1 Longin 7..121 CDD:341428 34/113 (30%)
Synaptobrevin 127..>195 CDD:395764 27/67 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53513
OrthoDB 1 1.010 - - D1211929at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21136
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.