DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and VAMP713

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001331552.1 Gene:VAMP713 / 830984 AraportID:AT5G11150 Length:226 Species:Arabidopsis thaliana


Alignment Length:219 Identity:79/219 - (36%)
Similarity:143/219 - (65%) Gaps:2/219 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPILYSVISRGTTVLAKFAECVGNFAEVTEHIIGRI--GVHNHKMTYTHGDYLIHYTCENKLVYM 63
            |.|::::::|||.||::|:....|.:.:::.|:.::  ...:..|:|:...|:.|....:.|..:
plant     1 MAIIFALVARGTVVLSEFSATSTNASSISKQILEKLPGNDSDSHMSYSQDRYIFHVKRTDGLTVL 65

  Fly    64 CITDNEFERSRAFLFLADIKQKFIQTYGLQVATAIAYSMNTEFSKILAQQMVYFSQSREVDTISR 128
            |:.|....|:..|.||.||.|:|::|||..:.:|.|||||.|||::|:|||.::|.....|.:||
plant    66 CMADETAGRNIPFAFLDDIHQRFVKTYGRAIHSAQAYSMNDEFSRVLSQQMEFYSNDPNADRMSR 130

  Fly   129 VHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASRNLARQMFWKNIRVYVVV 193
            :.|::.:::::|::|||.:.||||:|||||:||||:..|:..|||.:|.....|:|:|:::.:.:
plant   131 IKGEMSQVRNVMIENIDKVLDRGERLELLVDKTENMQGNTFRFRKQARRYRTIMWWRNVKLTIAL 195

  Fly   194 GLVITFIVYVIVSMACGGLAWQSC 217
            .||:..:||:.::..|.|.:..||
plant   196 ILVLALVVYIAMAFVCHGPSLPSC 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490 19/66 (29%)
Synaptobrevin 122..210 CDD:279324 33/87 (38%)
R-SNARE_VAMP7 124..188 CDD:277224 29/63 (46%)
VAMP713NP_001331552.1 Longin 4..119 CDD:341428 39/114 (34%)
Synaptobrevin 124..212 CDD:395764 33/87 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 90 1.000 Domainoid score I2658
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 177 1.000 Inparanoid score I1475
OMA 1 1.010 - - QHG53513
OrthoDB 1 1.010 - - D1211929at2759
OrthoFinder 1 1.000 - - FOG0004661
OrthoInspector 1 1.000 - - otm3539
orthoMCL 1 0.900 - - OOG6_101193
Panther 1 1.100 - - O PTHR21136
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3273
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.