DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and VAMP724

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_193313.6 Gene:VAMP724 / 827258 AraportID:AT4G15780 Length:184 Species:Arabidopsis thaliana


Alignment Length:173 Identity:55/173 - (31%)
Similarity:96/173 - (55%) Gaps:3/173 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LYSVISRGTTVLAKFAECVGNFAEVTEHIIGRI-GVHNHKMTYTHGDYLIHYTCENKLVYMCITD 67
            :||.::|||.:||::.|..|||..:....:.:: ...|.|.||....:..::..|:...|..:..
plant     7 IYSFVARGTMILAEYTEFTGNFPSIAAQCLQKLPSSSNSKFTYNCDHHTFNFLVEDGYAYCVVAK 71

  Fly    68 NEFERSRAFLFLADIKQKFIQTY-GLQVATAIAYSMNTEFSKILAQQMVYF-SQSREVDTISRVH 130
            :...:..:..||..:|..|.:.| |.:.:||||.|:|.||..::.:.|.|. ..:.|::.:.:|.
plant    72 DSLSKQISIAFLERVKADFKKRYGGGKASTAIAKSLNKEFGPVMKEHMNYIVDHAEEIEKLIKVK 136

  Fly   131 GQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRK 173
            .|:.|:|.||::|||...||||.|.:|.:|||||.:.:..::|
plant   137 AQVSEVKSIMLENIDKAIDRGENLTVLTDKTENLRSQAREYKK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490 12/66 (18%)
Synaptobrevin 122..210 CDD:279324 22/52 (42%)
R-SNARE_VAMP7 124..188 CDD:277224 21/50 (42%)
VAMP724NP_193313.6 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53513
OrthoDB 1 1.010 - - D1211929at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21136
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.