DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and VAMP727

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001078283.1 Gene:VAMP727 / 824597 AraportID:AT3G54300 Length:240 Species:Arabidopsis thaliana


Alignment Length:236 Identity:74/236 - (31%)
Similarity:131/236 - (55%) Gaps:23/236 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILYSVISRGTTVLAKFAECVGNFAEVTEHIIGRIGVHNHKMTYTHGDYLIHYTCENKLVYMCITD 67
            ::||.:::||.|||:.....|||:.:....:.::..::.|.||:...:..::..:|..|::.:.|
plant     6 LIYSFVAKGTVVLAEHTPYSGNFSTIAVQCLQKLPTNSSKYTYSCDGHTFNFLVDNGFVFLVVAD 70

  Fly    68 NEFERSRAFLFLADIKQKFIQTYGLQVAT--------------------AIAYSMNTEFSKILAQ 112
            ....||..|:||..:|:.|.:.|...:..                    ::||:::.||..||.:
plant    71 ESTGRSVPFVFLERVKEDFKKRYEASIKNDERHPLADEDEDDDLFGDRFSVAYNLDREFGPILKE 135

  Fly   113 QMVY-FSQSREVDTISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASR 176
            .|.| .|...|:..:|::..||.|:|.||:.||:.:.|||||:||||:|||||...:.:|::..|
plant   136 HMQYCMSHPEEMSKLSKLKAQITEVKGIMMDNIEKVLDRGEKIELLVDKTENLQFQADSFQRQGR 200

  Fly   177 NLARQMFWKNIRV-YVVVGLVITFIVYVIVSMACGGLAWQS 216
            .|.|:|:.::::: .:|.|.|.:||:.|.| :||||....|
plant   201 QLRRKMWLQSLQMKLMVAGAVFSFILIVWV-VACGGFKCSS 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490 14/84 (17%)
Synaptobrevin 122..210 CDD:279324 37/88 (42%)
R-SNARE_VAMP7 124..188 CDD:277224 28/63 (44%)
VAMP727NP_001078283.1 Longin 7..140 CDD:341428 31/132 (23%)
Synaptobrevin 146..234 CDD:395764 37/88 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53513
OrthoDB 1 1.010 - - D1211929at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21136
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.