DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and VAMP728

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001189966.1 Gene:VAMP728 / 822087 AraportID:AT3G24890 Length:124 Species:Arabidopsis thaliana


Alignment Length:97 Identity:23/97 - (23%)
Similarity:51/97 - (52%) Gaps:15/97 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 LAQQ-----MVYFSQSREVDTISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSV 169
            |.||     :|..:...|:..:::|...:.::|.:|::||:...||.||:::||:.....||  :
plant    11 LTQQLEQRVLVLLAHPEEISKLAKVKALVTKMKGVMMENIEKALDRSEKIKILVDLRSKYSN--L 73

  Fly   170 AFRKASR--------NLARQMFWKNIRVYVVV 193
            .|....:        .:.|:|:::|::..::|
plant    74 PFPSYGQEDIITPGTKITRKMWFQNMKFKLIV 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490
Synaptobrevin 122..210 CDD:279324 19/80 (24%)
R-SNARE_VAMP7 124..188 CDD:277224 17/71 (24%)
VAMP728NP_001189966.1 Synaptobrevin 28..107 CDD:279324 19/80 (24%)
SNARE 30..100 CDD:304603 17/71 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1211929at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.