DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and VAMP723

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_850201.1 Gene:VAMP723 / 817873 AraportID:AT2G33110 Length:217 Species:Arabidopsis thaliana


Alignment Length:211 Identity:57/211 - (27%)
Similarity:104/211 - (49%) Gaps:6/211 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILYSVISRGTTVLAKFAECVGNFAEVTEHIIGRIGVHNHKMTYTHGDYLIHYTCENKLVYMCITD 67
            :.||.|:|||.:|.:|.:..|||..|....:..:...|:|.||....:..:...||...|..:..
plant     6 LFYSFIARGTVILVEFTDFKGNFTSVAAQYLENLPSSNNKFTYNCDGHTFNDLVENGFTYCVVAV 70

  Fly    68 NEFERSRAFLFLADIKQKFIQTY-GLQVATAIAYSMNTEFSKILAQQMVY-FSQSREVDTISRVH 130
            :...|.....||..:|:.|.:.| |.:.||..|.|:|.||...|.:.|.| .....|:..:::..
plant    71 DSAGREIPMAFLERVKEDFYKRYGGEKAATDQANSLNKEFGSNLKEHMQYCMDHPDEISNLAKAK 135

  Fly   131 GQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASRNLARQMFWKNIRVYVVVGL 195
            .|:.|:|.:|::||:.:..||...|:|.:.    .:...||......:.|:.:::|:::.::|..
plant   136 AQVSEVKSLMMENIEKVLARGVICEMLGSS----ESQPQAFYIKRTQMKRKKWFQNMKIKLIVLA 196

  Fly   196 VITFIVYVIVSMACGG 211
            :|..::.:|:...|||
plant   197 IIIALILIIILSVCGG 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490 15/65 (23%)
Synaptobrevin 122..210 CDD:279324 18/87 (21%)
R-SNARE_VAMP7 124..188 CDD:277224 14/63 (22%)
VAMP723NP_850201.1 Longin 32..96 CDD:290490 13/63 (21%)
Synaptobrevin 127..>191 CDD:279324 15/67 (22%)
R-SNARE 130..184 CDD:277196 13/57 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53513
OrthoDB 1 1.010 - - D1211929at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21136
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.