DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and VAMP725

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_180826.2 Gene:VAMP725 / 817827 AraportID:AT2G32670 Length:285 Species:Arabidopsis thaliana


Alignment Length:212 Identity:73/212 - (34%)
Similarity:124/212 - (58%) Gaps:4/212 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILYSVISRGTTVLAKFAECVGNFAEVTEHIIGRIGVHNHKMTYTHGDYLIHYTCENKLVYMCITD 67
            ::||.::|||.:|.::.|..|||..|....:.::...|:|.||....:..:|..||...|..:..
plant    71 LIYSFVARGTVILVEYTEFKGNFTAVAAQCLQKLPSSNNKFTYNCDGHTFNYLVENGFTYCVVAV 135

  Fly    68 NEFERSRAFLFLADIKQKFIQTY-GLQVATAIAYSMNTEFSKILAQQMVY-FSQSREVDTISRVH 130
            ....|.....||..:|:.|.:.| |.:..||.|.|:|.||...|.:.|.| .....|:..:::|.
plant   136 ESVGRQIPMAFLERVKEDFNKRYGGGKATTAQANSLNREFGSKLKEHMQYCVDHPDEISKLAKVK 200

  Fly   131 GQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASRNLARQMFWKNIRV-YVVVG 194
            .|:.|:|.:|::||:.:.|||||:||||:|||||.:.:..||.....:.|:|:::|::: .:|:|
plant   201 AQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKIRRKMWFENMKIKLIVLG 265

  Fly   195 LVITFIVYVIVSMACGG 211
            ::||.|:.:|:|: |||
plant   266 IIITLILIIILSV-CGG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490 15/65 (23%)
Synaptobrevin 122..210 CDD:279324 34/88 (39%)
R-SNARE_VAMP7 124..188 CDD:277224 26/63 (41%)
VAMP725NP_180826.2 Longin 97..168 CDD:290490 17/70 (24%)
Synaptobrevin 192..>260 CDD:279324 27/67 (40%)
R-SNARE 195..253 CDD:277196 24/57 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53513
OrthoDB 1 1.010 - - D1211929at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21136
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.