DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and VAMP1

DIOPT Version :10

Sequence 1:NP_610524.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_055046.1 Gene:VAMP1 / 6843 HGNCID:12642 Length:118 Species:Homo sapiens


Alignment Length:80 Identity:23/80 - (28%)
Similarity:47/80 - (58%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 ISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASRNLARQMFWKNIRVY 190
            :.:...|::|:.||:..|:|.:.:|.:||..|.::.:.|...:..|..::..|.|:.:|||.::.
Human    34 LQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMM 98

  Fly   191 VVVGLVITFIVYVIV 205
            :::|.:...||.|||
Human    99 IMLGAICAIIVVVIV 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_610524.1 Longin 4..117 CDD:341428
R-SNARE_VAMP7 124..188 CDD:277224 17/61 (28%)
VAMP1NP_055046.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 0/1 (0%)
R-SNARE_VAMP2 32..94 CDD:277223 15/59 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.