DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and Ykt6

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_113880.2 Gene:Ykt6 / 64351 RGDID:70897 Length:198 Species:Rattus norvegicus


Alignment Length:199 Identity:56/199 - (28%)
Similarity:87/199 - (43%) Gaps:38/199 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LY--SVISRG--TTVLAKFAECVGNFA-----------EVTEHIIGRIGVHNHKMTYTHGDYLIH 53
            ||  ||..:|  ..||.|.|..|.:|:           ..|..:|........:.:....:||.|
  Rat     3 LYSLSVFYKGEPKAVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVERSAKGSRASVKEQEYLCH 67

  Fly    54 -YTCENKLVYMCITDNEFERSRAFLFLADIKQKFIQTYGLQV----------ATAIAYSMNTEFS 107
             |...:.|..:.|.|:|:....||..|    :|.:..:..||          ||....:::...|
  Rat    68 VYVRSDSLAGVVIADSEYPSRVAFTLL----EKVLDEFSKQVDRIDWPVGSPATIHYTALDGHLS 128

  Fly   108 KILAQQMVYFSQSREVDTISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFR 172
            :        :...||.|.:|:|..::||.|.|:...::||.:|||||:.||:|:|.|...|.||.
  Rat   129 R--------YQNPREADPMSKVQAELDETKIILHNTMESLLERGEKLDDLVSKSEVLGTQSKAFY 185

  Fly   173 KASR 176
            |.:|
  Rat   186 KTAR 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490 16/75 (21%)
Synaptobrevin 122..210 CDD:279324 25/55 (45%)
R-SNARE_VAMP7 124..188 CDD:277224 24/53 (45%)
Ykt6NP_113880.2 SNC1 3..198 CDD:227472 56/199 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.