Sequence 1: | NP_001286255.1 | Gene: | Vamp7 / 36015 | FlyBaseID: | FBgn0266186 | Length: | 218 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_113880.2 | Gene: | Ykt6 / 64351 | RGDID: | 70897 | Length: | 198 | Species: | Rattus norvegicus |
Alignment Length: | 199 | Identity: | 56/199 - (28%) |
---|---|---|---|
Similarity: | 87/199 - (43%) | Gaps: | 38/199 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 LY--SVISRG--TTVLAKFAECVGNFA-----------EVTEHIIGRIGVHNHKMTYTHGDYLIH 53
Fly 54 -YTCENKLVYMCITDNEFERSRAFLFLADIKQKFIQTYGLQV----------ATAIAYSMNTEFS 107
Fly 108 KILAQQMVYFSQSREVDTISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFR 172
Fly 173 KASR 176 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Vamp7 | NP_001286255.1 | Longin | 32..97 | CDD:290490 | 16/75 (21%) |
Synaptobrevin | 122..210 | CDD:279324 | 25/55 (45%) | ||
R-SNARE_VAMP7 | 124..188 | CDD:277224 | 24/53 (45%) | ||
Ykt6 | NP_113880.2 | SNC1 | 3..198 | CDD:227472 | 56/199 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5143 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |