DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and Ykt6

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_062635.2 Gene:Ykt6 / 56418 MGIID:1927550 Length:198 Species:Mus musculus


Alignment Length:200 Identity:60/200 - (30%)
Similarity:90/200 - (45%) Gaps:40/200 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LY--SVISRG--TTVLAKFAECVGNF-----AEVTEH-------IIGRIGVHNHKMTYTHGDYLI 52
            ||  ||:.:|  ..||.|.|..|.:|     :.|.|.       |:.|.| ...:.:....:||.
Mouse     3 LYSLSVLYKGDPKAVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVERSG-KGSRASVKEQEYLC 66

  Fly    53 H-YTCENKLVYMCITDNEFERSRAFLFLADIKQKFIQTYGLQV----------ATAIAYSMNTEF 106
            | |...:.|..:.|.|:|:....||..|    :|.:..:..||          ||.....::...
Mouse    67 HVYVRSDSLAGVVIADSEYPSRVAFTLL----EKVLDEFSKQVDRIDWPVGSPATIQYTGLDDHL 127

  Fly   107 SKILAQQMVYFSQSREVDTISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAF 171
            ||        :...||.|.:|:|..::||.|.|:...::||.:|||||:.||:|:|.|...|.||
Mouse   128 SK--------YQNPREADPMSKVQAELDETKIILHNTMESLLERGEKLDDLVSKSEVLGTQSKAF 184

  Fly   172 RKASR 176
            .|.:|
Mouse   185 YKTAR 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490 18/75 (24%)
Synaptobrevin 122..210 CDD:279324 24/54 (44%)
R-SNARE_VAMP7 124..188 CDD:277224 23/52 (44%)
Ykt6NP_062635.2 SNC1 3..198 CDD:227472 59/199 (30%)
Longin 44..107 CDD:290490 17/67 (25%)
R-SNARE_YKT6 136..195 CDD:277220 23/53 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.