Sequence 1: | NP_001286255.1 | Gene: | Vamp7 / 36015 | FlyBaseID: | FBgn0266186 | Length: | 218 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_062635.2 | Gene: | Ykt6 / 56418 | MGIID: | 1927550 | Length: | 198 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 60/200 - (30%) |
---|---|---|---|
Similarity: | 90/200 - (45%) | Gaps: | 40/200 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 LY--SVISRG--TTVLAKFAECVGNF-----AEVTEH-------IIGRIGVHNHKMTYTHGDYLI 52
Fly 53 H-YTCENKLVYMCITDNEFERSRAFLFLADIKQKFIQTYGLQV----------ATAIAYSMNTEF 106
Fly 107 SKILAQQMVYFSQSREVDTISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAF 171
Fly 172 RKASR 176 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Vamp7 | NP_001286255.1 | Longin | 32..97 | CDD:290490 | 18/75 (24%) |
Synaptobrevin | 122..210 | CDD:279324 | 24/54 (44%) | ||
R-SNARE_VAMP7 | 124..188 | CDD:277224 | 23/52 (44%) | ||
Ykt6 | NP_062635.2 | SNC1 | 3..198 | CDD:227472 | 59/199 (30%) |
Longin | 44..107 | CDD:290490 | 17/67 (25%) | ||
R-SNARE_YKT6 | 136..195 | CDD:277220 | 23/53 (43%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5143 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |