DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and sec22c

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_707343.1 Gene:sec22c / 558856 ZFINID:ZDB-GENE-060227-2 Length:303 Species:Danio rerio


Alignment Length:152 Identity:34/152 - (22%)
Similarity:62/152 - (40%) Gaps:43/152 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VISRGTTVLAKFAECVGNFAEVTEHIIGRIGVHNHKMTYTHGDYLIHY-TCENKLVYMCITDNEF 70
            :||:...||.:                 |..|..|::.       ||: :||. :.||.:.....
Zfish    39 IISKSLNVLPE-----------------RGTVKGHELN-------IHFLSCEG-VSYMSVCACTL 78

  Fly    71 ERSRAFLFLADIKQKFIQTYGLQVATAIA---YSMNTEFSKILAQQMVYFSQ----SREVDTISR 128
            ..:.||.||.|::.:|...:. ..|.|:|   |.. .||...:.:...:::|    |.|| |::.
Zfish    79 PAATAFCFLEDLRWEFTACFD-NSAVAMANRPYPF-LEFDSAIQKLQQHYNQKGGPSLEV-TLAE 140

  Fly   129 VH-------GQIDELKDIMVKN 143
            |.       .|:..::|:::.|
Zfish   141 VQEDLRSSPPQVLTMEDVVLSN 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490 16/65 (25%)
Synaptobrevin 122..210 CDD:279324 7/29 (24%)
R-SNARE_VAMP7 124..188 CDD:277224 5/27 (19%)
sec22cXP_707343.1 Longin 38..102 CDD:290490 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.