DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and vamp4

DIOPT Version :10

Sequence 1:NP_610524.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001016897.1 Gene:vamp4 / 549651 XenbaseID:XB-GENE-965232 Length:141 Species:Xenopus tropicalis


Alignment Length:82 Identity:34/82 - (41%)
Similarity:55/82 - (67%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 DTISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASRNLARQMFWKNIR 188
            |.|..|..|:||:.|:|.:||..:.:|||:|:.|.:|:|:||:|:.||...||.|.|||:|:..:
 Frog    51 DKIRHVQNQVDEVIDVMQENITRVIERGERLDELQDKSESLSDNATAFSSRSRQLRRQMWWRECK 115

  Fly   189 VYVVVGLVITFIVYVIV 205
            :..::.||...|:.||:
 Frog   116 MKAIIALVFVIILLVII 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_610524.1 Longin 4..117 CDD:341428
R-SNARE_VAMP7 124..188 CDD:277224 29/63 (46%)
vamp4NP_001016897.1 R-SNARE_VAMP4 50..116 CDD:277222 29/64 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.