DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and si:ch73-234b20.5

DIOPT Version :10

Sequence 1:NP_610524.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001280112.1 Gene:si:ch73-234b20.5 / 449923 ZFINID:ZDB-GENE-041008-183 Length:101 Species:Danio rerio


Alignment Length:83 Identity:26/83 - (31%)
Similarity:62/83 - (74%) Gaps:0/83 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 ISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASRNLARQMFWKNIRVY 190
            :::|..|::::|.|:..||:.:.:|||:|:.|:.||::|...:.:|::.|.::||:|:|:|.::.
Zfish    15 LNQVQDQVNDVKVILKDNINKVLERGERLDDLIGKTDDLQATADSFQRTSTHVARKMWWRNTKMM 79

  Fly   191 VVVGLVITFIVYVIVSMA 208
            :::|:|:..|:.:|:.:|
Zfish    80 IIIGVVVVAIIVLIIVLA 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_610524.1 Longin 4..117 CDD:341428
R-SNARE_VAMP7 124..188 CDD:277224 21/61 (34%)
si:ch73-234b20.5NP_001280112.1 SNARE 12..79 CDD:473982 21/63 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.