DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and Vamp4

DIOPT Version :10

Sequence 1:NP_610524.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001102326.1 Gene:Vamp4 / 364033 RGDID:1309753 Length:141 Species:Rattus norvegicus


Alignment Length:83 Identity:30/83 - (36%)
Similarity:55/83 - (66%) Gaps:0/83 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 DTISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASRNLARQMFWKNIR 188
            |.|..|..|:||:.|:|.:||..:.:|||:|:.|.:|:|:||:|:.||...|:.|.|||:|:..:
  Rat    51 DKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCK 115

  Fly   189 VYVVVGLVITFIVYVIVS 206
            :..::.|....::.:|::
  Rat   116 IKAIMALAAAILLLMIIT 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_610524.1 Longin 4..117 CDD:341428
R-SNARE_VAMP7 124..188 CDD:277224 28/63 (44%)
Vamp4NP_001102326.1 R-SNARE_VAMP4 50..116 CDD:277222 28/64 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.