DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and sec22bb

DIOPT Version :9

Sequence 1:NP_001286255.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001315455.1 Gene:sec22bb / 327277 ZFINID:ZDB-GENE-030131-5488 Length:219 Species:Danio rerio


Alignment Length:163 Identity:42/163 - (25%)
Similarity:78/163 - (47%) Gaps:2/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 HKMTYTHGDYLIHYTCENKLVYMCITDNEFERSRAFLFLADIKQKFIQTYGLQVATAIAYSMNTE 105
            ::.|...|....||..|..:.|:.:.:..|.:..||.:|.|::.:|.:.:|.:|.|........|
Zfish    54 NRCTLEAGSMSFHYVIEKGVCYLVLCEAGFPKKLAFAYLEDLQAEFHEQHGKKVPTVSRPYSFIE 118

  Fly   106 FSKILAQQMVYFSQSREVDTISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVA 170
            |...:.:....:..||....:|.::.::.:::.|||.||:.:..|||.|..|.:|..|||:.|..
Zfish   119 FDTYIQKTKKSYIDSRARRNLSNINTELQDVQRIMVANIEEVLQRGEALSALDSKASNLSSLSKK 183

  Fly   171 FRKASRNLARQMFWKNIRVYVVVGLVITFIVYV 203
            :|..::.|..:..:..:....|  ..|..|||:
Zfish   184 YRSDAKYLNTRSTYAKLAAGGV--FFIMLIVYI 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_001286255.1 Longin 32..97 CDD:290490 14/55 (25%)
Synaptobrevin 122..210 CDD:279324 23/82 (28%)
R-SNARE_VAMP7 124..188 CDD:277224 18/63 (29%)
sec22bbNP_001315455.1 SNC1 12..192 CDD:227472 36/137 (26%)
Longin 41..107 CDD:290490 13/52 (25%)
R-SNARE_SEC22 136..199 CDD:277219 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.