DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vamp7 and vamp5

DIOPT Version :10

Sequence 1:NP_610524.1 Gene:Vamp7 / 36015 FlyBaseID:FBgn0266186 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001243535.1 Gene:vamp5 / 325484 ZFINID:ZDB-GENE-030131-4209 Length:112 Species:Danio rerio


Alignment Length:80 Identity:21/80 - (26%)
Similarity:43/80 - (53%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 ISRVHGQIDELKDIMVKNIDSLRDRGEKLELLVNKTENLSNNSVAFRKASRNLARQMFWKNIRVY 190
            :|.....::|:|.||:.|::...:|..||:.|..:.::|.....||.|.:..:.::..|:||:..
Zfish     8 LSEAQKDVEEVKGIMLDNLNKAEERSGKLKELETRADDLLVKGKAFSKTATKVKQKKRWENIKYK 72

  Fly   191 VVVGLVITFIVYVIV 205
            ||:..|...::..|:
Zfish    73 VVIAAVAAAVLLGII 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vamp7NP_610524.1 Longin 4..117 CDD:341428
R-SNARE_VAMP7 124..188 CDD:277224 16/61 (26%)
vamp5NP_001243535.1 R-SNARE_VAMP5 5..72 CDD:277225 17/63 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.